ANKMY2 antibody (N-Term)

Catalog No. ABIN632127

Product Details anti-ANKMY2 Antibody

Target: ANKMY2 (Ankyrin Repeat and MYND Domain Containing 2 (ANKMY2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANKMY2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ANKMY2 antibody was raised against the N terminal of ANKMY2

Purification: Affinity purified

Immunogen: ANKMY2 antibody was raised using the N terminal of ANKMY2 corresponding to a region with amino acids DVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRERLDYYTKPQGLDKEPKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANKMY2 Blocking Peptide, catalog no. 33R-2226, is also available for use as a blocking control in assays to test for specificity of this ANKMY2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKMY2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANKMY2

Target: ANKMY2 (Ankyrin Repeat and MYND Domain Containing 2 (ANKMY2))

Alternative Name: ANKMY2 (ANKMY2 Products)

Synonyms: ZMYND20 antibody, AI035571 antibody, Gna14 antibody, ankmy2 antibody, si:dkeyp-25a3.5 antibody, fi46e08 antibody, wu:fi46e08 antibody, zgc:55491 antibody, ankyrin repeat and MYND domain containing 2 antibody, ankyrin repeat and MYND domain containing 2b antibody, ankyrin repeat and MYND domain containing 2a antibody, ANKMY2 antibody, Ankmy2 antibody, ankmy2b antibody, ankmy2a antibody

Background: The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 49 kDa (MW of target protein)