Adenylate Kinase 5 antibody (N-Term)

Catalog No. ABIN632129

The Rabbit Polyclonal anti-Adenylate Kinase 5 antibody has been validated for WB. It is suitable to detect Adenylate Kinase 5 in samples from Human.

Quick Overview for Adenylate Kinase 5 antibody (N-Term) (ABIN632129)

Target: Adenylate Kinase 5 (AK5)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Adenylate Kinase 5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Adenylate Kinase 5 Antibody

Binding Specificity: N-Term

Specificity: AK5 antibody was raised against the N terminal of AK5

Purification: Affinity purified

Immunogen: AK5 antibody was raised using the N terminal of AK5 corresponding to a region with amino acids ESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AK5 Blocking Peptide, (ABIN938107), is also available for use as a blocking control in assays to test for specificity of this AK5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Adenylate Kinase 5

Target: Adenylate Kinase 5 (AK5)

Alternative Name: AK5

Background: This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.

Molecular Weight: 62 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process