ACTR3B antibody

Catalog No. ABIN632130

This anti-ACTR3B antibody is a Rabbit Polyclonal antibody detecting ACTR3B in WB. Suitable for Human.

Quick Overview for ACTR3B antibody (ABIN632130)

Target: ACTR3B (ARP3 Actin-Related Protein 3 Homolog B (ACTR3B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACTR3B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ACTR3B Antibody

Purification: Affinity purified

Immunogen: ACTR3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACTR3B Blocking Peptide, (ABIN5611926), is also available for use as a blocking control in assays to test for specificity of this ACTR3B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACTR3B

Target: ACTR3B (ARP3 Actin-Related Protein 3 Homolog B (ACTR3B))

Alternative Name: ACTR3B

Background: ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization