IFIT3 antibody (N-Term)

Catalog No. ABIN632163

This anti-IFIT3 antibody is a Rabbit Polyclonal antibody detecting IFIT3 in WB and IHC. Suitable for Human.

Quick Overview for IFIT3 antibody (N-Term) (ABIN632163)

Target: IFIT3 (Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IFIT3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-IFIT3 Antibody

Binding Specificity: N-Term

Specificity: IFIT3 antibody was raised against the N terminal of IFIT3

Purification: Affinity purified

Immunogen: IFIT3 antibody was raised using the N terminal of IFIT3 corresponding to a region with amino acids ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IFIT3 Blocking Peptide, (ABIN936954), is also available for use as a blocking control in assays to test for specificity of this IFIT3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFIT3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IFIT3

Target: IFIT3 (Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3))

Alternative Name: IFIT3

Background: IFIT3 is involved in protein binding.

Molecular Weight: 56 kDa (MW of target protein)