EIF3E antibody (N-Term)

Catalog No. ABIN632164

This Rabbit Polyclonal antibody specifically detects EIF3E in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for EIF3E antibody (N-Term) (ABIN632164)

Target: EIF3E (Eukaryotic Translation Initiation Factor 3 Subunit E (EIF3E))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF3E antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EIF3E Antibody

Binding Specificity: N-Term

Specificity: EIF3 E antibody was raised against the N terminal of EIF3

Purification: Affinity purified

Immunogen: EIF3 E antibody was raised using the N terminal of EIF3 corresponding to a region with amino acids ELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF3E Blocking Peptide, (ABIN937943), is also available for use as a blocking control in assays to test for specificity of this EIF3E antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF3E

Target: EIF3E (Eukaryotic Translation Initiation Factor 3 Subunit E (EIF3E))

Alternative Name: EIF3E

Background: EIF3E belongs to the eIF-3 subunit E family.It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. EIF3E is required for nonsense-mediated mRNA decay (NMD), It may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. The protein may interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Hepatitis C