COPS4 antibody

Catalog No. ABIN632182

Product Details anti-COPS4 Antibody

Target: COPS4 (COP9 Signalosome Subunit 4 (COPS4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COPS4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: COPS4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

COPS4 Blocking Peptide, catalog no. 33R-10150, is also available for use as a blocking control in assays to test for specificity of this COPS4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPS4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COPS4

Target: COPS4 (COP9 Signalosome Subunit 4 (COPS4))

Alternative Name: COPS4 (COPS4 Products)

Background: COPS4 is one of eight subunits composing COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Cell Division Cycle