Carabin antibody (N-Term)

Catalog No. ABIN632187

Product Details anti-Carabin Antibody

Target: Carabin (TBC1D10C) (TBC1 Domain Family, Member 10C (TBC1D10C))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Carabin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TBC1 D11 antibody was raised against the N terminal of TBC1 11

Purification: Affinity purified

Immunogen: TBC1 D11 antibody was raised using the N terminal of TBC1 11 corresponding to a region with amino acids MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TBC1D10C Blocking Peptide, catalog no. 33R-5722, is also available for use as a blocking control in assays to test for specificity of this TBC1D10C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Carabin

Target: Carabin (TBC1D10C) (TBC1 Domain Family, Member 10C (TBC1D10C))

Alternative Name: TBC1D10C (TBC1D10C Products)

Synonyms: CARABIN antibody, EPI64C antibody, 1810062O14Rik antibody, AI428527 antibody, RGD1311490 antibody, TBC1 domain family member 10C antibody, TBC1 domain family, member 10c antibody, TBC1 domain family, member 10C antibody, TBC1D10C antibody, Tbc1d10c antibody

Background: TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.Carabin is an endogenous inhibitor of calcineurin that also inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein activity.

Molecular Weight: 50 kDa (MW of target protein)