LYPLA2 antibody (N-Term)

Catalog No. ABIN632189

Product Details anti-LYPLA2 Antibody

Target: LYPLA2 (Lysophospholipase II (LYPLA2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LYPLA2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LYPLA2 antibody was raised against the N terminal of LYPLA2

Purification: Affinity purified

Immunogen: LYPLA2 antibody was raised using the N terminal of LYPLA2 corresponding to a region with amino acids MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LYPLA2 Blocking Peptide, catalog no. 33R-5812, is also available for use as a blocking control in assays to test for specificity of this LYPLA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPLA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LYPLA2

Target: LYPLA2 (Lysophospholipase II (LYPLA2))

Alternative Name: LYPLA2 (LYPLA2 Products)

Synonyms: APT-2 antibody, DJ886K2.4 antibody, LysoII antibody, MGC52664 antibody, MGC75683 antibody, LYPLA2P1 antibody, lysophospholipase II antibody, lysophospholipase 2 antibody, lysophospholipase II S homeolog antibody, LYPLA2 antibody, Lypla2 antibody, lypla2.S antibody, lypla2 antibody

Background: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.

Molecular Weight: 25 kDa (MW of target protein)