Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Choline Kinase alpha antibody (CHKA) (Middle Region) Primary Antibody

CHKA Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN632201
$672.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    Choline Kinase alpha (CHKA)
    Binding Specificity
    • 8
    • 7
    • 4
    • 4
    • 2
    • 1
    • 1
    • 1
    • 1
    Middle Region
    Reactivity
    • 31
    • 12
    • 6
    • 4
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 36
    • 3
    Rabbit
    Clonality
    • 39
    Polyclonal
    Conjugate
    • 20
    • 7
    • 3
    • 3
    • 2
    • 2
    • 2
    This Choline Kinase alpha antibody is un-conjugated
    Application
    • 36
    • 28
    • 8
    • 6
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    Western Blotting (WB)
    Specificity
    CHKA antibody was raised against the middle region of CHKA
    Purification
    Affinity purified
    Immunogen
    CHKA antibody was raised using the middle region of CHKA corresponding to a region with amino acids LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    CHKA Blocking Peptide, catalog no. 33R-4929, is also available for use as a blocking control in assays to test for specificity of this CHKA antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHKA antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    Choline Kinase alpha (CHKA)
    Alternative Name
    CHKA (CHKA Antibody Abstract)
    Synonyms
    im:7143625, wu:fd46h01, si:dkey-12e7.3, CHKA, chkb, ATCK1, CHOLINE KINASE, CK, F14O23.8, F14O23_8, choline kinase 1, CHK, CKI, EK, CK/EK-alpha, Chetk-alpha, Chk, ChoK, EtnK-alpha, CK-R, choline kinase alpha, choline kinase, choline kinase 1, chka, CHKA, MCYG_00090, PF14_0020, CK1, CNI01400, Chka
    Background
    The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. CHKA is the initial enzyme in the sequence and may play a regulatory role. It also catalyzes the phosphorylation of ethanolamine.
    Molecular Weight
    50 kDa (MW of target protein)
You are here:
help Support