ASB11 antibody (C-Term)

Catalog No. ABIN632206

Product Details anti-ASB11 Antibody

Target: ASB11 (Ankyrin Repeat and SOCS Box-Containing 11 (ASB11))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASB11 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ASB11 antibody was raised against the C terminal of ASB11

Purification: Affinity purified

Immunogen: ASB11 antibody was raised using the C terminal of ASB11 corresponding to a region with amino acids GQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSV

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASB11 Blocking Peptide, catalog no. 33R-3519, is also available for use as a blocking control in assays to test for specificity of this ASB11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASB11

Target: ASB11 (Ankyrin Repeat and SOCS Box-Containing 11 (ASB11))

Alternative Name: ASB11 (ASB11 Products)

Synonyms: ASB11 antibody, asb-a antibody, zgc:136370 antibody, zgc:158532 antibody, DKFZp468G0324 antibody, 1110067L12Rik antibody, 1600009D24Rik antibody, RGD1566298 antibody, ankyrin repeat and SOCS box-containing 11 antibody, ankyrin repeat and SOCS box containing 11 antibody, ASB11 antibody, asb11 antibody, Asb11 antibody

Background: ASB11 is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation.

Molecular Weight: 33 kDa (MW of target protein)