ASB11 antibody (C-Term)

Catalog No. ABIN632206

This Rabbit Polyclonal antibody specifically detects ASB11 in WB. It exhibits reactivity toward Human.

Quick Overview for ASB11 antibody (C-Term) (ABIN632206)

Target: ASB11 (Ankyrin Repeat and SOCS Box-Containing 11 (ASB11))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASB11 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ASB11 Antibody

Binding Specificity: C-Term

Specificity: ASB11 antibody was raised against the C terminal of ASB11

Purification: Affinity purified

Immunogen: ASB11 antibody was raised using the C terminal of ASB11 corresponding to a region with amino acids GQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSV

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASB11 Blocking Peptide, (ABIN938905), is also available for use as a blocking control in assays to test for specificity of this ASB11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASB11

Target: ASB11 (Ankyrin Repeat and SOCS Box-Containing 11 (ASB11))

Alternative Name: ASB11

Background: ASB11 is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation.

Molecular Weight: 33 kDa (MW of target protein)