BCKDK antibody (N-Term)
-
- Target See all BCKDK Antibodies
- BCKDK (Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BCKDK antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BCKDK antibody was raised against the N terminal of BCKDK
- Purification
- Affinity purified
- Immunogen
- BCKDK antibody was raised using the N terminal of BCKDK corresponding to a region with amino acids CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD
- Top Product
- Discover our top product BCKDK Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BCKDK Blocking Peptide, catalog no. 33R-1742, is also available for use as a blocking control in assays to test for specificity of this BCKDK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCKDK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BCKDK (Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK))
- Alternative Name
- BCKDK (BCKDK Products)
- Background
- BCkDaK belongs to the PDK/BCkDaK protein kinase family. It contains 1 histidine kinase domain. BCkDaK catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex, the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. BCkDaK is the key enzyme that regulates the activity state of the BCkDa complex.
- Molecular Weight
- 43 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-