BCKDK antibody (N-Term)

Catalog No. ABIN632248

This Rabbit Polyclonal antibody specifically detects BCKDK in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for BCKDK antibody (N-Term) (ABIN632248)

Target: BCKDK (Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BCKDK antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BCKDK Antibody

Binding Specificity: N-Term

Specificity: BCKDK antibody was raised against the N terminal of BCKDK

Purification: Affinity purified

Immunogen: BCKDK antibody was raised using the N terminal of BCKDK corresponding to a region with amino acids CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BCKDK Blocking Peptide, (ABIN937128), is also available for use as a blocking control in assays to test for specificity of this BCKDK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCKDK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BCKDK

Target: BCKDK (Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK))

Alternative Name: BCKDK

Background: BCkDaK belongs to the PDK/BCkDaK protein kinase family. It contains 1 histidine kinase domain. BCkDaK catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex, the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. BCkDaK is the key enzyme that regulates the activity state of the BCkDa complex.

Molecular Weight: 43 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome