TPRN antibody (Middle Region)
-
- Target See all TPRN Antibodies
- TPRN (Taperin (TPRN))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TPRN antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C9 ORF75 antibody was raised against the middle region of C9 rf75
- Purification
- Affinity purified
- Immunogen
- C9 ORF75 antibody was raised using the middle region of C9 rf75 corresponding to a region with amino acids PPFLPAASEEAEPAEGLRVPGLAKNSREYVRPGLPVTFIDEVDSEEAPQA
- Top Product
- Discover our top product TPRN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C9ORF75 Blocking Peptide, catalog no. 33R-7251, is also available for use as a blocking control in assays to test for specificity of this C9ORF75 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF75 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TPRN (Taperin (TPRN))
- Alternative Name
- C9ORF75 (TPRN Products)
- Background
- The specific function of C9orf75 is not yet known.
- Molecular Weight
- 72 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-