IDI1 antibody (Middle Region)

Catalog No. ABIN632278

Product Details anti-IDI1 Antibody

Target: IDI1 (Isopentenyl-Diphosphate delta Isomerase 1 (IDI1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IDI1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IDI1 antibody was raised against the middle region of IDI1

Purification: Affinity purified

Immunogen: IDI1 antibody was raised using the middle region of IDI1 corresponding to a region with amino acids PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IDI1 Blocking Peptide, catalog no. 33R-7208, is also available for use as a blocking control in assays to test for specificity of this IDI1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IDI1

Target: IDI1 (Isopentenyl-Diphosphate delta Isomerase 1 (IDI1))

Alternative Name: IDI1 (IDI1 Products)

Synonyms: zgc:114138 antibody, 4832416K17Rik antibody, ipp1 antibody, ippl1 antibody, IPP1 antibody, IPPI1 antibody, isopentenyl-diphosphate delta isomerase 1 antibody, isopentenyl-diphosphate delta isomerase antibody, isopentenyl-diphosphate delta isomerase 1 L homeolog antibody, idi1 antibody, Idi1 antibody, idi1.L antibody, IDI1 antibody

Background: IDI1 is a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity.

Molecular Weight: 32 kDa (MW of target protein)