ADHFE1 antibody (Middle Region)

Catalog No. ABIN632283

This anti-ADHFE1 antibody is a Rabbit Polyclonal antibody detecting ADHFE1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for ADHFE1 antibody (Middle Region) (ABIN632283)

Target: ADHFE1 (Alcohol Dehydrogenase, Iron Containing, 1 (ADHFE1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADHFE1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ADHFE1 Antibody

Binding Specificity: Middle Region

Specificity: ADHFE1 antibody was raised against the middle region of ADHFE1

Purification: Affinity purified

Immunogen: ADHFE1 antibody was raised using the middle region of ADHFE1 corresponding to a region with amino acids RIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPIS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADHFE1 Blocking Peptide, (ABIN5611952), is also available for use as a blocking control in assays to test for specificity of this ADHFE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADHFE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADHFE1

Target: ADHFE1 (Alcohol Dehydrogenase, Iron Containing, 1 (ADHFE1))

Alternative Name: ADHFE1

Background: ADHFE1 is hydroxyacid-oxoacid transhydrogenase, which is responsible for the oxidation of 4-hydroxybutyrate in mammalian tissues.

Molecular Weight: 50 kDa (MW of target protein)