ADHFE1 antibody (Middle Region)
-
- Target See all ADHFE1 Antibodies
- ADHFE1 (Alcohol Dehydrogenase, Iron Containing, 1 (ADHFE1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADHFE1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ADHFE1 antibody was raised against the middle region of ADHFE1
- Purification
- Affinity purified
- Immunogen
- ADHFE1 antibody was raised using the middle region of ADHFE1 corresponding to a region with amino acids RIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPIS
- Top Product
- Discover our top product ADHFE1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ADHFE1 Blocking Peptide, catalog no. 33R-7987, is also available for use as a blocking control in assays to test for specificity of this ADHFE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADHFE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADHFE1 (Alcohol Dehydrogenase, Iron Containing, 1 (ADHFE1))
- Alternative Name
- ADHFE1 (ADHFE1 Products)
- Synonyms
- adh-8 antibody, adh8 antibody, zgc:77479 antibody, ADHFE1 antibody, ADH8 antibody, HOT antibody, 6330565B14Rik antibody, AI043035 antibody, Adh8 antibody, alcohol dehydrogenase, iron containing 1 antibody, alcohol dehydrogenase, iron containing, 1 antibody, alcohol dehydrogenase, iron containing 1 S homeolog antibody, adhfe1 antibody, ADHFE1 antibody, adhfe1.S antibody, Adhfe1 antibody
- Background
- ADHFE1 is hydroxyacid-oxoacid transhydrogenase, which is responsible for the oxidation of 4-hydroxybutyrate in mammalian tissues.
- Molecular Weight
- 50 kDa (MW of target protein)
-