ARL11 antibody (Middle Region)

Catalog No. ABIN632291

Product Details anti-ARL11 Antibody

Target: ARL11 (ADP-Ribosylation Factor-Like 11 (ARL11))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARL11 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARL11 antibody was raised against the middle region of ARL11

Purification: Affinity purified

Immunogen: ARL11 antibody was raised using the middle region of ARL11 corresponding to a region with amino acids WKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARL11 Blocking Peptide, catalog no. 33R-9959, is also available for use as a blocking control in assays to test for specificity of this ARL11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARL11

Target: ARL11 (ADP-Ribosylation Factor-Like 11 (ARL11))

Alternative Name: ARL11 (ARL11 Products)

Synonyms: zgc:56090 antibody, wu:fc38d01 antibody, arl11 antibody, MGC89886 antibody, ARL11 antibody, MGC154392 antibody, ARLTS1 antibody, C730007L20Rik antibody, ADP-ribosylation factor-like 11 antibody, ADP ribosylation factor like GTPase 11 antibody, ADP-ribosylation factor like GTPase 11 antibody, arl11 antibody, ARL11 antibody, Arl11 antibody

Background: ARL11 belongs to the small GTPase superfamily, Arf family. It may play a role in apoptosis and act as a tumor suppressor. Defects in ARL11 may be a cause of susceptibility to chronic lymphocytic leukemia (CLL).

Molecular Weight: 21 kDa (MW of target protein)