LCA5 antibody (N-Term)

Catalog No. ABIN632308

This Rabbit Polyclonal antibody specifically detects LCA5 in WB. It exhibits reactivity toward Human.

Quick Overview for LCA5 antibody (N-Term) (ABIN632308)

Target: LCA5 (Leber Congenital Amaurosis 5 (LCA5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LCA5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LCA5 Antibody

Binding Specificity: N-Term

Specificity: LCA5 antibody was raised against the N terminal of LCA5

Purification: Affinity purified

Immunogen: LCA5 antibody was raised using the N terminal of LCA5 corresponding to a region with amino acids FSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LCA5 Blocking Peptide, (ABIN938457), is also available for use as a blocking control in assays to test for specificity of this LCA5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LCA5

Target: LCA5 (Leber Congenital Amaurosis 5 (LCA5))

Alternative Name: LCA5

Background: LCA5 is a protein that is thought to be involved in centrosomal or ciliary functions. Mutations in this gene cause Leber congenital amaurosis type V. Mutations in this gene cause Leber congenital amaurosis type V. Alternative splicing results in two transcript variants.

Molecular Weight: 80 kDa (MW of target protein)