DCTPP1 antibody (Middle Region)
-
- Target See all DCTPP1 Antibodies
- DCTPP1 (DCTP Pyrophosphatase 1 (DCTPP1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DCTPP1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- XTP3 TPA antibody was raised against the middle region of XTP3 PA
- Purification
- Affinity purified
- Immunogen
- XTP3 TPA antibody was raised using the middle region of XTP3 PA corresponding to a region with amino acids KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST
- Top Product
- Discover our top product DCTPP1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
XTP3TPA Blocking Peptide, catalog no. 33R-4552, is also available for use as a blocking control in assays to test for specificity of this XTP3TPA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XTP0 PA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DCTPP1 (DCTP Pyrophosphatase 1 (DCTPP1))
- Alternative Name
- XTP3TPA (DCTPP1 Products)
- Synonyms
- RS21C6 antibody, XTP3TPA antibody, 2410015N17Rik antibody, AI854235 antibody, RS21-C6 antibody, Rs21c6 antibody, Xtp3tpa antibody, xtp3tpa antibody, dCTP pyrophosphatase 1 antibody, dCTP pyrophosphatase 1 L homeolog antibody, DCTPP1 antibody, Dctpp1 antibody, dctpp1.L antibody, dctpp1 antibody
- Background
- XTP3TPA is involved in identical protein binding, dCTP diphosphatase activity and pyrimidine deoxyribonucleotide binding.
- Molecular Weight
- 19 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-