NDRG2 antibody (C-Term)
-
- Target See all NDRG2 Antibodies
- NDRG2 (NDRG Family Member 2 (NDRG2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NDRG2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NDRG2 antibody was raised against the C terminal of NDRG2
- Purification
- Affinity purified
- Immunogen
- NDRG2 antibody was raised using the C terminal of NDRG2 corresponding to a region with amino acids GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG
- Top Product
- Discover our top product NDRG2 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NDRG2 Blocking Peptide, catalog no. 33R-3680, is also available for use as a blocking control in assays to test for specificity of this NDRG2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDRG2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NDRG2 (NDRG Family Member 2 (NDRG2))
- Alternative Name
- NDRG2 (NDRG2 Products)
- Synonyms
- NDRG2 antibody, AI182517 antibody, AU040374 antibody, Ndr2 antibody, SYLD antibody, im:6909381 antibody, si:dkey-88n24.1 antibody, zgc:101847 antibody, NDRG family member 2 antibody, N-myc downstream regulated gene 2 antibody, NDRG family member 2 S homeolog antibody, ndrg2 antibody, NDRG2 antibody, Ndrg2 antibody, ndrg2.S antibody
- Background
- The NDRG2 gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. NDRG2 is a cytoplasmic protein that may play a role in neurite outgrowth. Its gene may be involved in glioblastoma carcinogenesis.
- Molecular Weight
- 39 kDa (MW of target protein)
-