NDRG2 antibody (C-Term)

Catalog No. ABIN632346

Product Details anti-NDRG2 Antibody

Target: NDRG2 (NDRG Family Member 2 (NDRG2))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NDRG2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NDRG2 antibody was raised against the C terminal of NDRG2

Purification: Affinity purified

Immunogen: NDRG2 antibody was raised using the C terminal of NDRG2 corresponding to a region with amino acids GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NDRG2 Blocking Peptide, catalog no. 33R-3680, is also available for use as a blocking control in assays to test for specificity of this NDRG2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDRG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NDRG2

Target: NDRG2 (NDRG Family Member 2 (NDRG2))

Alternative Name: NDRG2 (NDRG2 Products)

Synonyms: NDRG2 antibody, AI182517 antibody, AU040374 antibody, Ndr2 antibody, SYLD antibody, im:6909381 antibody, si:dkey-88n24.1 antibody, zgc:101847 antibody, NDRG family member 2 antibody, N-myc downstream regulated gene 2 antibody, NDRG family member 2 S homeolog antibody, ndrg2 antibody, NDRG2 antibody, Ndrg2 antibody, ndrg2.S antibody

Background: The NDRG2 gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. NDRG2 is a cytoplasmic protein that may play a role in neurite outgrowth. Its gene may be involved in glioblastoma carcinogenesis.

Molecular Weight: 39 kDa (MW of target protein)