RWDD2A antibody (N-Term)

Catalog No. ABIN632350

Product Details anti-RWDD2A Antibody

Target: RWDD2A (RWD Domain Containing 2A (RWDD2A))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RWDD2A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RWDD2 A antibody was raised against the N terminal of RWDD2

Purification: Affinity purified

Immunogen: RWDD2 A antibody was raised using the N terminal of RWDD2 corresponding to a region with amino acids NALTNIKRYLEGTREALPPKIEFVITLQIEEPKVKIDLQVTMPHSYPYVA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RWDD2A Blocking Peptide, catalog no. 33R-6639, is also available for use as a blocking control in assays to test for specificity of this RWDD2A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RWDD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RWDD2A

Target: RWDD2A (RWD Domain Containing 2A (RWDD2A))

Alternative Name: RWDD2A (RWDD2A Products)

Synonyms: RWDD2 antibody, dJ747H23.2 antibody, 1700030C20Rik antibody, AI848608 antibody, Rwdd2 antibody, RWD domain containing 2A antibody, RWDD2A antibody, Rwdd2a antibody

Background: The specific function of RWDD2A is not yet known.

Molecular Weight: 32 kDa (MW of target protein)