DENND2C antibody (Middle Region)

Catalog No. ABIN632358

The Rabbit Polyclonal anti-DENND2C antibody (ABIN632358) specifically detects DENND2C in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for DENND2C antibody (Middle Region) (ABIN632358)

Target: DENND2C (DENN/MADD Domain Containing 2C (DENND2C))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DENND2C antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DENND2C Antibody

Binding Specificity: Middle Region

Specificity: DENND2 C antibody was raised against the middle region of DENND2

Purification: Affinity purified

Immunogen: DENND2 C antibody was raised using the middle region of DENND2 corresponding to a region with amino acids DIFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DENND2C Blocking Peptide, (ABIN937380), is also available for use as a blocking control in assays to test for specificity of this DENND2C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DENND0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DENND2C

Target: DENND2C (DENN/MADD Domain Containing 2C (DENND2C))

Alternative Name: DENND2C

Background: The specific function of DENND2C is not yet known.

Molecular Weight: 100 kDa (MW of target protein)