SENP5 antibody (Middle Region)

Catalog No. ABIN632368

This Rabbit Polyclonal antibody specifically detects SENP5 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for SENP5 antibody (Middle Region) (ABIN632368)

Target: SENP5 (SUMO1/sentrin Specific Peptidase 5 (SENP5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SENP5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SENP5 Antibody

Binding Specificity: Middle Region

Specificity: SENP5 antibody was raised against the middle region of SENP5

Purification: Affinity purified

Immunogen: SENP5 antibody was raised using the middle region of SENP5 corresponding to a region with amino acids LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SENP5 Blocking Peptide, (ABIN5616044), is also available for use as a blocking control in assays to test for specificity of this SENP5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SENP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SENP5

Target: SENP5 (SUMO1/sentrin Specific Peptidase 5 (SENP5))

Alternative Name: SENP5

Background: The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins is required for numerous biologic processes. SUMO-specific proteases, such as SENP5, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates.

Molecular Weight: 87 kDa (MW of target protein)