OTUB1 antibody (N-Term)
-
- Target See all OTUB1 Antibodies
- OTUB1 (OTU Domain, Ubiquitin Aldehyde Binding 1 (OTUB1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This OTUB1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- OTUB1 antibody was raised against the N terminal of OTUB1
- Purification
- Affinity purified
- Immunogen
- OTUB1 antibody was raised using the N terminal of OTUB1 corresponding to a region with amino acids DRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRK
- Top Product
- Discover our top product OTUB1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
OTUB1 Blocking Peptide, catalog no. 33R-2145, is also available for use as a blocking control in assays to test for specificity of this OTUB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTUB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OTUB1 (OTU Domain, Ubiquitin Aldehyde Binding 1 (OTUB1))
- Alternative Name
- OTUB1 (OTUB1 Products)
- Synonyms
- OTB1 antibody, OTU1 antibody, AI850305 antibody, fa19h07 antibody, otub1 antibody, wu:fa19h07 antibody, zgc:92839 antibody, MGC131231 antibody, fb17f04 antibody, otub1l antibody, wu:fb17f04 antibody, zgc:92685 antibody, OTU deubiquitinase, ubiquitin aldehyde binding 1 antibody, OTU domain, ubiquitin aldehyde binding 1 antibody, OTU deubiquitinase, ubiquitin aldehyde binding 1b antibody, OTU deubiquitinase, ubiquitin aldehyde binding 1 L homeolog antibody, similar to HSPC263 antibody, OTU deubiquitinase, ubiquitin aldehyde binding 1a antibody, OTUB1 antibody, Otub1 antibody, otub1b antibody, otub1.L antibody, otub1 antibody, RGD1565010 antibody, otub1a antibody
- Background
- The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitin.
- Molecular Weight
- 31 kDa (MW of target protein)
-