GFOD1 antibody (Middle Region)

Catalog No. ABIN632377

Product Details anti-GFOD1 Antibody

Target: GFOD1 (Glucose-Fructose Oxidoreductase Domain Containing 1 (GFOD1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GFOD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GFOD1 antibody was raised against the middle region of GFOD1

Purification: Affinity purified

Immunogen: GFOD1 antibody was raised using the middle region of GFOD1 corresponding to a region with amino acids NSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAAT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GFOD1 Blocking Peptide, catalog no. 33R-6883, is also available for use as a blocking control in assays to test for specificity of this GFOD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GFOD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GFOD1

Target: GFOD1 (Glucose-Fructose Oxidoreductase Domain Containing 1 (GFOD1))

Alternative Name: GFOD1 (GFOD1 Products)

Synonyms: MGC75800 antibody, gfod1 antibody, ADG-90 antibody, C6orf114 antibody, 9630032O13 antibody, AI850995 antibody, glucose-fructose oxidoreductase domain containing 1 antibody, glucose-fructose oxidoreductase domain-containing protein 1 antibody, si:ch211-276f18.2 antibody, uncharacterized LOC100411032 antibody, Gfod1 antibody, gfod1 antibody, GFOD1 antibody, LOC520966 antibody, si:ch211-276f18.2 antibody, LOC100411032 antibody, LOC100460871 antibody

Background: The function of GFOD1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 43 kDa (MW of target protein)