Desmin antibody (Middle Region)

Catalog No. ABIN632380

This Rabbit Polyclonal antibody specifically detects Desmin in WB. It exhibits reactivity toward Human, Rat, Mouse and Dog.

Quick Overview for Desmin antibody (Middle Region) (ABIN632380)

Target: Desmin (DES)

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Desmin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Desmin Antibody

Binding Specificity: Middle Region

Specificity: Desmin antibody was raised against the middle region of DES

Purification: Affinity purified

Immunogen: Desmin antibody was raised using the middle region of DES corresponding to a region with amino acids MALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Desmin Blocking Peptide, (ABIN5613180), is also available for use as a blocking control in assays to test for specificity of this Desmin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DES antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Desmin

Target: Desmin (DES)

Alternative Name: Desmin

Background: DES is a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in its gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.

Molecular Weight: 53 kDa (MW of target protein)