gamma 1 Adaptin antibody (C-Term)
-
- Target See all gamma 1 Adaptin (AP1G1) Antibodies
- gamma 1 Adaptin (AP1G1) (Adaptor-Related Protein Complex 1, gamma 1 Subunit (AP1G1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This gamma 1 Adaptin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- AP1 G1 antibody was raised against the C terminal of AP1 1
- Purification
- Affinity purified
- Immunogen
- AP1 G1 antibody was raised using the C terminal of AP1 1 corresponding to a region with amino acids DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS
- Top Product
- Discover our top product AP1G1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AP1G1 Blocking Peptide, catalog no. 33R-1979, is also available for use as a blocking control in assays to test for specificity of this AP1G1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- gamma 1 Adaptin (AP1G1) (Adaptor-Related Protein Complex 1, gamma 1 Subunit (AP1G1))
- Alternative Name
- AP1G1 (AP1G1 Products)
- Synonyms
- ADTG antibody, CLAPG1 antibody, AA409002 antibody, AU041323 antibody, AW551707 antibody, Adtg antibody, D8Ertd374e antibody, adtg antibody, wu:fc30a11 antibody, zgc:56079 antibody, AP1G1 antibody, adaptor related protein complex 1 gamma 1 subunit antibody, AP-1 complex subunit gamma-1 antibody, AP-1 adaptor complex gamma subunit Apl4 antibody, hypothetical protein antibody, adaptor protein complex AP-1, gamma 1 subunit antibody, adaptor-related protein complex 1, gamma 1 subunit antibody, adaptor related protein complex 1 gamma 1 subunit L homeolog antibody, gamma-adaptin antibody, AP1G1 antibody, NCU04121 antibody, PTRG_00081 antibody, SJAG_01809 antibody, UREG_02085 antibody, BDBG_07402 antibody, PAAG_11376 antibody, MCYG_00840 antibody, PITG_11143 antibody, VDBG_09354 antibody, Ap1g1 antibody, ap1g1 antibody, ap1g1.L antibody, ANI_1_330014 antibody, AOR_1_802184 antibody, MGYG_01130 antibody, EDI_324200 antibody, TERG_00390 antibody, Tsp_09544 antibody
- Background
- Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. AP1G1 is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family.
- Molecular Weight
- 91 kDa (MW of target protein)
-