C20orf141 antibody (Middle Region)

Catalog No. ABIN632400

The Rabbit Polyclonal anti-C20orf141 antibody (ABIN632400) specifically detects C20orf141 in WB. The antibody is reactive with Human samples.

Quick Overview for C20orf141 antibody (Middle Region) (ABIN632400)

Target: C20orf141 (Chromosome 20 Open Reading Frame 141 (C20orf141))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C20orf141 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C20orf141 Antibody

Binding Specificity: Middle Region

Specificity: C20 ORF141 antibody was raised against the middle region of C20 rf141

Purification: Affinity purified

Immunogen: C20 ORF141 antibody was raised using the middle region of C20 rf141 corresponding to a region with amino acids RKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMGLGPLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C20ORF141 Blocking Peptide, (ABIN5612478), is also available for use as a blocking control in assays to test for specificity of this C20ORF141 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF141 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C20orf141

Target: C20orf141 (Chromosome 20 Open Reading Frame 141 (C20orf141))

Alternative Name: C20ORF141

Background: C20orf141 is a single-pass membrane protein. The exact function of C20orf141 remains unknown.

Molecular Weight: 17 kDa (MW of target protein)