ICA1 antibody (C-Term)

Catalog No. ABIN632403

This anti-ICA1 antibody is a Rabbit Polyclonal antibody detecting ICA1 in WB. Suitable for Human and Mouse.

Quick Overview for ICA1 antibody (C-Term) (ABIN632403)

Target: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ICA1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ICA1 Antibody

Binding Specificity: C-Term

Specificity: ICA1 antibody was raised against the C terminal of ICA1

Purification: Affinity purified

Immunogen: ICA1 antibody was raised using the C terminal of ICA1 corresponding to a region with amino acids NMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ICA1 Blocking Peptide, (ABIN5614123), is also available for use as a blocking control in assays to test for specificity of this ICA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ICA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ICA1

Target: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Alternative Name: ICA1

Background: ICA1 is a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome.

Molecular Weight: 53 kDa (MW of target protein)