SCFD1 antibody (N-Term)

Catalog No. ABIN632406

Product Details anti-SCFD1 Antibody

Target: SCFD1 (Sec1 Family Domain Containing 1 (SCFD1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SCFD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SCFD1 antibody was raised against the N terminal of SCFD1

Purification: Affinity purified

Immunogen: SCFD1 antibody was raised using the N terminal of SCFD1 corresponding to a region with amino acids SAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEME

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SCFD1 Blocking Peptide, catalog no. 33R-8323, is also available for use as a blocking control in assays to test for specificity of this SCFD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCFD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SCFD1

Target: SCFD1 (Sec1 Family Domain Containing 1 (SCFD1))

Alternative Name: SCFD1 (SCFD1 Products)

Synonyms: DDBDRAFT_0188070 antibody, DDBDRAFT_0234142 antibody, DDB_0188070 antibody, DDB_0234142 antibody, C14orf163 antibody, RA410 antibody, SLY1 antibody, SLY1P antibody, STXBP1L2 antibody, 3110021P21Rik antibody, Sly1 antibody, rSly1 antibody, sec1 family domain containing 1 antibody, vesicle transport-related protein antibody, Sec1-like family protein antibody, sec1 family domain-containing protein 1 antibody, sec1 family domain containing 1 L homeolog antibody, Sec1 family domain containing 1 antibody, SCFD1 antibody, PVX_111025 antibody, scfd1 antibody, LOC100639066 antibody, scfd1.L antibody, Scfd1 antibody

Background: The function of SCFD1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 65 kDa (MW of target protein)