LIN37 antibody

Catalog No. ABIN632413

This Rabbit Polyclonal antibody specifically detects LIN37 in WB. It exhibits reactivity toward Human.

Quick Overview for LIN37 antibody (ABIN632413)

Target: LIN37 (Lin-37 Homolog (LIN37))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIN37 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LIN37 Antibody

Purification: Affinity purified

Immunogen: LIN37 antibody was raised using a synthetic peptide corresponding to a region with amino acids HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LIN37 Blocking Peptide, (ABIN939214), is also available for use as a blocking control in assays to test for specificity of this LIN37 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIN37 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LIN37

Target: LIN37 (Lin-37 Homolog (LIN37))

Alternative Name: LIN37

Background: This gene encodes a protein expressed in the eye.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Cell Division Cycle, Mitotic G1-G1/S Phases