EIF2B1 antibody (C-Term)

Catalog No. ABIN632422

This Rabbit Polyclonal antibody specifically detects EIF2B1 in WB. It exhibits reactivity toward Human.

Quick Overview for EIF2B1 antibody (C-Term) (ABIN632422)

Target: EIF2B1 (Eukaryotic Translation Initiation Factor 2B, Subunit 1 Alpha, 26kDa (EIF2B1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF2B1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EIF2B1 Antibody

Binding Specificity: C-Term

Specificity: EIF2 B1 antibody was raised against the C terminal of EIF2 1

Purification: Affinity purified

Immunogen: EIF2 B1 antibody was raised using the C terminal of EIF2 1 corresponding to a region with amino acids ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF2B1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this EIF2B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF2B1

Target: EIF2B1 (Eukaryotic Translation Initiation Factor 2B, Subunit 1 Alpha, 26kDa (EIF2B1))

Alternative Name: EIF2B1

Background: EIF2B1 belongs to the EIF-2B alpha/beta/delta subunits family. It catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Defects in EIF2B1 are a cause of leukoencephalopathy with vanishing white matter (VWM).

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process