Lactate Dehydrogenase A antibody (Middle Region)

Catalog No. ABIN632424

The Rabbit Polyclonal anti-Lactate Dehydrogenase A antibody (ABIN632424) specifically detects Lactate Dehydrogenase A in WB. The antibody is reactive with Human samples.

Quick Overview for Lactate Dehydrogenase A antibody (Middle Region) (ABIN632424)

Target: Lactate Dehydrogenase A (LDHA)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Lactate Dehydrogenase A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Lactate Dehydrogenase A Antibody

Binding Specificity: Middle Region

Specificity: LDHA antibody was raised against the middle region of LDHA

Purification: Affinity purified

Immunogen: LDHA antibody was raised using the middle region of LDHA corresponding to a region with amino acids PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LDHA Blocking Peptide, (ABIN5614432), is also available for use as a blocking control in assays to test for specificity of this LDHA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Lactate Dehydrogenase A

Target: Lactate Dehydrogenase A (LDHA)

Alternative Name: LDHA

Background: LDHA catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Warburg Effect