Lactate Dehydrogenase A antibody (Middle Region)
-
- Target See all Lactate Dehydrogenase A (LDHA) Antibodies
- Lactate Dehydrogenase A (LDHA)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Lactate Dehydrogenase A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LDHA antibody was raised against the middle region of LDHA
- Purification
- Affinity purified
- Immunogen
- LDHA antibody was raised using the middle region of LDHA corresponding to a region with amino acids PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH
- Top Product
- Discover our top product LDHA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LDHA Blocking Peptide, catalog no. 33R-7206, is also available for use as a blocking control in assays to test for specificity of this LDHA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Lactate Dehydrogenase A (LDHA)
- Alternative Name
- LDHA (LDHA Products)
- Synonyms
- GSD11 antibody, LDH1 antibody, LDHM antibody, LDH-M antibody, ldh-h antibody, ldha antibody, ldha-B antibody, ldhbb antibody, trg-5 antibody, Ldh1 antibody, Ldhm antibody, l7R2 antibody, gsd11 antibody, ldh-m antibody, ldh1 antibody, ldhm antibody, pig19 antibody, ldha1 antibody, ldhab antibody, LDH-A antibody, LDHC antibody, lactate dehydrogenase A antibody, lactate dehydrogenase B L homeolog antibody, lactate dehydrogenase A4 antibody, lactate dehydrogenase A L homeolog antibody, L-lactate dehydrogenase A chain antibody, LDHA antibody, ldhb.L antibody, Ldha antibody, ldha antibody, ldha.L antibody, LOC100713875 antibody
- Background
- LDHA catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria.
- Molecular Weight
- 37 kDa (MW of target protein)
- Pathways
- Warburg Effect
-