Kallikrein 2 antibody (Middle Region)

Catalog No. ABIN632433

This anti-Kallikrein 2 antibody is a Rabbit Polyclonal antibody detecting Kallikrein 2 in WB. Suitable for Human.

Quick Overview for Kallikrein 2 antibody (Middle Region) (ABIN632433)

Target: Kallikrein 2 (KLK2)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Kallikrein 2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Kallikrein 2 Antibody

Binding Specificity: Middle Region

Specificity: KLK2 antibody was raised against the middle region of KLK2

Purification: Affinity purified

Immunogen: KLK2 antibody was raised using the middle region of KLK2 corresponding to a region with amino acids KHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASG

Application Details

Application Notes: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLK2 Blocking Peptide, (ABIN939805), is also available for use as a blocking control in assays to test for specificity of this KLK2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Kallikrein 2

Target: Kallikrein 2 (KLK2)

Alternative Name: KLK2

Background: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Complement System