GTPBP2 antibody (N-Term)

Catalog No. ABIN632438

Product Details anti-GTPBP2 Antibody

Target: GTPBP2 (GTP Binding Protein 2 (GTPBP2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GTPBP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GTPBP2 antibody was raised against the N terminal of GTPBP2

Purification: Affinity purified

Immunogen: GTPBP2 antibody was raised using the N terminal of GTPBP2 corresponding to a region with amino acids GCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GTPBP2 Blocking Peptide, catalog no. 33R-3185, is also available for use as a blocking control in assays to test for specificity of this GTPBP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GTPBP2

Target: GTPBP2 (GTP Binding Protein 2 (GTPBP2))

Alternative Name: GTPBP2 (GTPBP2 Products)

Synonyms: si:ch211-151i8.2 antibody, si:dkeyp-34c12.3 antibody, GB1 antibody, ZGB1 antibody, GTP binding protein 2 antibody, GTP binding protein 2 L homeolog antibody, GTP binding protein 2b antibody, GTPBP2 antibody, Gtpbp2 antibody, gtpbp2.L antibody, gtpbp2b antibody, gbp2 antibody

Background: GTP-binding proteins, or G proteins, constitute a superfamily capable of binding GTP or GDP. G proteins are activated by binding GTP and are inactivated by hydrolyzing GTP to GDP. This general mechanism enables G proteins to perform a wide range of biologic activities.

Molecular Weight: 66 kDa (MW of target protein)