Chromosome 6 Open Reading Frame 134 (C6orf134) (Middle Region) antibody

Catalog No. ABIN632439

The Rabbit Polyclonal anti-Chromosome 6 Open Reading Frame 134 antibody (ABIN632439) specifically detects Chromosome 6 Open Reading Frame 134 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for Chromosome 6 Open Reading Frame 134 (C6orf134) (Middle Region) antibody (ABIN632439)

Target: Chromosome 6 Open Reading Frame 134 (C6orf134)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: Middle Region

Specificity: C6 ORF134 antibody was raised against the middle region of C6 rf134

Purification: Affinity purified

Immunogen: C6 ORF134 antibody was raised using the middle region of C6 rf134 corresponding to a region with amino acids DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAID

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C6ORF134 Blocking Peptide, (ABIN937274), is also available for use as a blocking control in assays to test for specificity of this C6ORF134 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF134 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Chromosome 6 Open Reading Frame 134 (C6orf134)

Alternative Name: C6ORF134

Background: The function of C6orf134 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 36 kDa (MW of target protein)