Destrin antibody

Catalog No. ABIN632457

Product Details anti-Destrin Antibody

Target: Destrin (DSTN) (Destrin (Actin Depolymerizing Factor) (DSTN))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Destrin antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Destrin antibody was raised using a synthetic peptide corresponding to a region with amino acids ASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Destrin Blocking Peptide, catalog no. 33R-1510, is also available for use as a blocking control in assays to test for specificity of this Destrin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DSTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Destrin

Target: Destrin (DSTN) (Destrin (Actin Depolymerizing Factor) (DSTN))

Alternative Name: Destrin (DSTN Products)

Background: DSTN belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. It is the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin).

Molecular Weight: 18 kDa (MW of target protein)