C9orf25 antibody (Middle Region)

Catalog No. ABIN632464

This Rabbit Polyclonal antibody specifically detects C9orf25 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for C9orf25 antibody (Middle Region) (ABIN632464)

Target: C9orf25 (Chromosome 9 Open Reading Frame 25 (C9orf25))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C9orf25 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C9orf25 Antibody

Binding Specificity: Middle Region

Specificity: C9 ORF25 antibody was raised against the middle region of C9 rf25

Purification: Affinity purified

Immunogen: C9 ORF25 antibody was raised using the middle region of C9 rf25 corresponding to a region with amino acids SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C9ORF25 Blocking Peptide, catalog no. 33R-8849, is also available for use as a blocking control in assays to test for specificity of this C9ORF25 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C9orf25

Target: C9orf25 (Chromosome 9 Open Reading Frame 25 (C9orf25))

Alternative Name: C9ORF25

Background: The protein encoded by this gene has homologs that have been identified in mouse and macaque. The mouse and human proteins have a putative prenyl group binding site (CAAX box) at their C-terminus. A diverse list of proteins are known or strongly presumed to be the target of post-translational modification by the attachment of either a farnesyl or a geranyl-geranyl group to a cysteine residue at the C-terminus.

Molecular Weight: 18 kDa (MW of target protein)