Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

TBC1D16 antibody (TBC1 Domain Family, Member 16) (N-Term) Primary Antibody

TBC1D16 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN632485
$672.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    TBC1D16
    Binding Specificity
    • 2
    • 2
    • 1
    • 1
    • 1
    N-Term
    Reactivity
    • 8
    • 6
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    Human
    Host
    • 6
    • 2
    Rabbit
    Clonality
    • 8
    Polyclonal
    Application
    • 8
    • 1
    Western Blotting (WB)
    Specificity
    TBC1 D16 antibody was raised against the N terminal of TBC1 16
    Purification
    Affinity purified
    Immunogen
    TBC1 D16 antibody was raised using the N terminal of TBC1 16 corresponding to a region with amino acids EMLGATLILAWVPNSRIQRQDEEALRYITPESSPVRKAPRPRGRRTRSSG
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    TBC1D16 Blocking Peptide, catalog no. 33R-2588, is also available for use as a blocking control in assays to test for specificity of this TBC1D16 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 16 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    TBC1D16
    Alternative Name
    TBC1D16 (TBC1D16 Antibody Abstract)
    Synonyms
    B930087K01, BC026530, Tcd1d16, TBC1 domain family member 16, TBC1 domain family, member 16, TBC1D16, Tbc1d16
    Background
    TBC1D16 may act as a GTPase-activating protein for Rab family proteins.
    Molecular Weight
    86 kDa (MW of target protein)
You are here:
help Support