ODF2 antibody (N-Term)
-
- Target See all ODF2 Antibodies
- ODF2 (Outer Dense Fiber of Sperm Tails 2 (ODF2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ODF2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ODF2 antibody was raised against the N terminal of ODF2
- Purification
- Affinity purified
- Immunogen
- ODF2 antibody was raised using the N terminal of ODF2 corresponding to a region with amino acids MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKG
- Top Product
- Discover our top product ODF2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ODF2 Blocking Peptide, catalog no. 33R-6401, is also available for use as a blocking control in assays to test for specificity of this ODF2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ODF2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ODF2 (Outer Dense Fiber of Sperm Tails 2 (ODF2))
- Alternative Name
- ODF2 (ODF2 Products)
- Synonyms
- odf84 antibody, odf2/1 antibody, odf2/2 antibody, DKFZp469J0214 antibody, CT134 antibody, ODF2/1 antibody, ODF2/2 antibody, ODF84 antibody, si:dkey-228b2.4 antibody, AI848335 antibody, MMTEST29 antibody, outer dense fiber of sperm tails 2 antibody, outer dense fiber of sperm tails 2a antibody, outer dense fiber of sperm tails 2 L homeolog antibody, ODF2 antibody, odf2 antibody, odf2a antibody, odf2.L antibody, Odf2 antibody
- Background
- The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. ODF2 is one of the major outer dense fiber proteins.
- Molecular Weight
- 70 kDa (MW of target protein)
- Pathways
- M Phase
-