Retinoic Acid Induced 12 (RAI12) (C-Term) antibody

Catalog No. ABIN632532

Product Details

Target: Retinoic Acid Induced 12 (RAI12)

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: C17 ORF81 antibody was raised against the C terminal Of C17 rf81

Purification: Affinity purified

Immunogen: C17 ORF81 antibody was raised using the C terminal Of C17 rf81 corresponding to a region with amino acids FSILPDFSLDLQEGPSVESQPYSDPHIPPVSKNAKARTRKCSLVSGHGRE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C17ORF81 Blocking Peptide, catalog no. 33R-3064, is also available for use as a blocking control in assays to test for specificity of this C17ORF81 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF81 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Retinoic Acid Induced 12 (RAI12)

Alternative Name: C17ORF81 (RAI12 Products)

Synonyms: C17orf81 antibody, DERP6 antibody, MST071 antibody, MSTP071 antibody, Derp6 antibody, Rai12 antibody, derp6 antibody, rai12 antibody, zgc:158278 antibody, zgc:158285 antibody, elongator acetyltransferase complex subunit 5 antibody, ELP5 antibody, Elp5 antibody, elp5 antibody

Background: C17orf81 belongs to the ELP5 family. C17orf81 may be involved in TP53-mediated transcriptional regulation.

Molecular Weight: 31 kDa (MW of target protein)