APOA2 antibody (N-Term)

Catalog No. ABIN632553

This anti-APOA2 antibody is a Rabbit Polyclonal antibody detecting APOA2 in WB. Suitable for Human.

Quick Overview for APOA2 antibody (N-Term) (ABIN632553)

Target: APOA2 (Apolipoprotein A-II (APOA2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APOA2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-APOA2 Antibody

Binding Specificity: N-Term

Specificity: ApoA-II antibody was raised against the N terminal of APOA2

Purification: Affinity purified

Immunogen: ApoA-II antibody was raised using the N terminal of APOA2 corresponding to a region with amino acids MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ApoA-II Blocking Peptide, (ABIN5612110), is also available for use as a blocking control in assays to test for specificity of this ApoA-II antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APOA2

Target: APOA2 (Apolipoprotein A-II (APOA2))

Alternative Name: ApoA-II

Background: This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.

Molecular Weight: 9 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha, Production of Molecular Mediator of Immune Response, Negative Regulation of Transporter Activity, Lipid Metabolism