PNMA-Like 1 antibody (Middle Region)

Catalog No. ABIN632561

The Rabbit Polyclonal anti-PNMA-Like 1 antibody is suitable to detect PNMA-Like 1 in samples from Human. It has been validated for WB.

Quick Overview for PNMA-Like 1 antibody (Middle Region) (ABIN632561)

Target: PNMA-Like 1 (PNMAL1)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PNMA-Like 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PNMA-Like 1 Antibody

Binding Specificity: Middle Region

Specificity: PNMAL1 antibody was raised against the middle region of PNMAL1

Purification: Affinity purified

Immunogen: PNMAL1 antibody was raised using the middle region of PNMAL1 corresponding to a region with amino acids APMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PNMAL1 Blocking Peptide, (ABIN936816), is also available for use as a blocking control in assays to test for specificity of this PNMAL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNMAL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PNMA-Like 1

Target: PNMA-Like 1 (PNMAL1)

Alternative Name: PNMAL1

Background: The function of PNMAL1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 48 kDa (MW of target protein)