RSBN1 antibody (N-Term)

Catalog No. ABIN632562

This anti-RSBN1 antibody is a Rabbit Polyclonal antibody detecting RSBN1 in WB. Suitable for Human.

Quick Overview for RSBN1 antibody (N-Term) (ABIN632562)

Target: RSBN1 (Round Spermatid Basic Protein 1 (RSBN1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RSBN1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RSBN1 Antibody

Binding Specificity: N-Term

Specificity: RSBN1 antibody was raised against the N terminal of RSBN1

Purification: Affinity purified

Immunogen: RSBN1 antibody was raised using the N terminal of RSBN1 corresponding to a region with amino acids GGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RSBN1 Blocking Peptide, (ABIN938659), is also available for use as a blocking control in assays to test for specificity of this RSBN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSBN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RSBN1

Target: RSBN1 (Round Spermatid Basic Protein 1 (RSBN1))

Alternative Name: RSBN1

Background: RSBN1 may be involved in protein binding.

Molecular Weight: 90 kDa (MW of target protein)