PRSS22 antibody (N-Term)

Catalog No. ABIN632566

Product Details anti-PRSS22 Antibody

Target: PRSS22 (Protease, serine, 22 (PRSS22))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRSS22 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRSS22 antibody was raised against the N terminal of PRSS22

Purification: Affinity purified

Immunogen: PRSS22 antibody was raised using the N terminal of PRSS22 corresponding to a region with amino acids IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRSS22 Blocking Peptide, catalog no. 33R-4104, is also available for use as a blocking control in assays to test for specificity of this PRSS22 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRSS22

Target: PRSS22 (Protease, serine, 22 (PRSS22))

Alternative Name: PRSS22 (PRSS22 Products)

Synonyms: BSSP-4 antibody, hBSSP-4 antibody, 4733401N09Rik antibody, SP001LA antibody, protease, serine, 22 antibody, protease, serine 22 antibody, Prss22 antibody, PRSS22 antibody

Background: This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16.

Molecular Weight: 34 kDa (MW of target protein)