TMEM42 antibody (N-Term)

Catalog No. ABIN632584

Product Details anti-TMEM42 Antibody

Target: TMEM42 (Transmembrane Protein 42 (TMEM42))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM42 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM42 antibody was raised against the N terminal of TMEM42

Purification: Affinity purified

Immunogen: TMEM42 antibody was raised using the N terminal of TMEM42 corresponding to a region with amino acids MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRRFWGVFNCLCAGAFG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM42 Blocking Peptide, catalog no. 33R-5645, is also available for use as a blocking control in assays to test for specificity of this TMEM42 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM42

Target: TMEM42 (Transmembrane Protein 42 (TMEM42))

Alternative Name: TMEM42 (TMEM42 Products)

Synonyms: 0610027O18Rik antibody, 4933429E06Rik antibody, AV003444 antibody, D9Ertd662e antibody, transmembrane protein 42 antibody, TMEM42 antibody, Tmem42 antibody

Background: The function of TMEM42 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 17 kDa (MW of target protein)