WDFY1 antibody (N-Term)

Catalog No. ABIN632585

The Rabbit Polyclonal anti-WDFY1 antibody has been validated for WB. It is suitable to detect WDFY1 in samples from Human.

Quick Overview for WDFY1 antibody (N-Term) (ABIN632585)

Target: WDFY1 (WD Repeat and FYVE Domain Containing 1 (WDFY1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDFY1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-WDFY1 Antibody

Binding Specificity: N-Term

Specificity: WDFY1 antibody was raised against the N terminal of WDFY1

Purification: Affinity purified

Immunogen: WDFY1 antibody was raised using the N terminal of WDFY1 corresponding to a region with amino acids MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDFY1 Blocking Peptide, (ABIN5616993), is also available for use as a blocking control in assays to test for specificity of this WDFY1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDFY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDFY1

Target: WDFY1 (WD Repeat and FYVE Domain Containing 1 (WDFY1))

Alternative Name: WDFY1

Background: The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes.

Molecular Weight: 46 kDa (MW of target protein)