RHOB antibody (Middle Region)

Catalog No. ABIN632603

Product Details anti-RHOB Antibody

Target: RHOB (Ras Homolog Gene Family, Member B (RHOB))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RHOB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RHOB antibody was raised against the middle region of RHOB

Purification: Affinity purified

Immunogen: RHOB antibody was raised using the middle region of RHOB corresponding to a region with amino acids CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RHOB Blocking Peptide, catalog no. 33R-1769, is also available for use as a blocking control in assays to test for specificity of this RHOB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RHOB

Target: RHOB (Ras Homolog Gene Family, Member B (RHOB))

Alternative Name: RHOB (RHOB Products)

Synonyms: ARH6 antibody, ARHB antibody, MST081 antibody, MSTP081 antibody, RHOH6 antibody, AA017882 antibody, Arh6 antibody, Arhb antibody, RHO antibody, arha antibody, rhoa antibody, wu:fj42e08 antibody, zgc:92206 antibody, rhob antibody, xrhob antibody, ras homolog family member B antibody, ras homolog gene family, member Ab antibody, ras homolog family member B S homeolog antibody, RHOB antibody, Rhob antibody, rhoab antibody, rhob.S antibody

Background: RHOB mediates apoptosis in neoplastically transformed cells after DNA damage.RHOB is not essential for development but affects cell adhesion and growth factor signaling in transformed cells.RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. RHOB is involved in intracellular protein trafficking of a number of proteins.RHOB targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes.

Molecular Weight: 22 kDa (MW of target protein)