PLA2G4E antibody (C-Term)

Catalog No. ABIN632624

The Rabbit Polyclonal anti-PLA2G4E antibody has been validated for WB. It is suitable to detect PLA2G4E in samples from Human.

Quick Overview for PLA2G4E antibody (C-Term) (ABIN632624)

Target: PLA2G4E (Phospholipase A2, Group IVE (PLA2G4E))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLA2G4E antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PLA2G4E Antibody

Binding Specificity: C-Term

Specificity: PLA2 G2 antibody was raised against the c terminal of PLA2 2

Purification: Affinity purified

Immunogen: PLA2 G2 antibody was raised using the C terminal of PLA2 2 corresponding to a region with amino acids TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLA2G4E Blocking Peptide, (ABIN5615402), is also available for use as a blocking control in assays to test for specificity of this PLA2G4E antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLA0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLA2G4E

Target: PLA2G4E (Phospholipase A2, Group IVE (PLA2G4E))

Alternative Name: PLA2G4E

Background: PLA2G4E is a calcium-dependent phospholipase A2 that selectively hydrolyzes glycerophospholipids in the sn-2 position.

Molecular Weight: 96 kDa (MW of target protein)

Pathways: Inositol Metabolic Process, VEGF Signaling